Meanwhile on reddit they are Shadowbanning This Post on Every Sub I Try to Post it.

submitted by raven9 from self.MeanwhileOnReddit

There Are At Least TWO Lab Engineered Versions of SARS-CoV-2

The first is the one analysed by the scientists from India in January 2020. It's spike protein is almost identical to the spike on the original SARS-CoV-1 virus except for four new spliced in gene fragments that matched sequences from HIV-1. Those scientists published the genome of that spike protein in their paper, you can view that genome sequence here. https://www.biorxiv.org/content/biorxiv/early/2020/01/31/2020.01.30.927871/F2.large.jpg

You can see they aligned the new SARS-CoV-2 sequence above the original SARS to highlight where they are different.

I reference the four inserts here by their position in that genome.

076: GTNGTKR

148: YYHKNNKS

256: GDSSSG

681: QTNSPRRA

Now look here at this SARS-CoV-2 Spike genome on the NCBI website. https://www.ncbi.nlm.nih.gov/protein/6VXX_C (scroll to the bottom of the page to see it).

You might notice the 4 inserts are also present here but they are 15 places further up because the beginning part of this genome is different from the first one.

091: GTNGTKR

163: YYHKNNKS

271: GDSSSG

696: QTNSPSGA

Now look at the end part of that genome at position 1246 (near the end of the second to last row after GGGGS).

You will see this part of the genome is also different to the first one, the sequence beginning at position 1246 and ending at 1273 is,

GYIPE APRDGQAYVR KDGEWVLLST FLG

Now look at the genome for the gp41 protein in HIV-1.

https://www.ncbi.nlm.nih.gov/protein/2LP7_A?report=genbank&log$=protalign&blast_rank=1&RID=KDYSNY2A01R

You see the HIV gp41 protein is a relatively short sequence of 58 nucleotides.

GYIPEAPRDG QAYVRKDGEW VLLSTFLGSS GNEQELLELD KWASLWNWFN ITNWLWYIK

Now I put the sequence we just examined from the SARS-CoV-2 Spike genome above the HIV-1 gp41 sequence to compare them.

SARS-CoV-2: GYIPEAPRDGQAYVRKDGEWVLLSTFLG

HIV-1 GP-41: GYIPEAPRDGQAYVRKDGEWVLLSTFLGSS GNEQELLELD KWASLWNWFN ITNWLWYIK

You can see the matching sequence of the 28 nucleotides. This sequence was not present in the first genome from the Indian research paper.

What this means is, there was not just a leak of one virus from a lab. These are two distinct and separate versions of the same virus. The first had 4 sequences from HIV-1 in it's spike protein. The second has 5.

This means everything we have been told up to this point about the pandemic has been a pack of lies. These two distinctly different versions of the same virus were not an accidental leak. This was obviously deliberate and they created some kind of an HIV-SARS hybrid.

all 32 comments
sorted by:
top
newinsightfulfun

[–][deleted] 6 insightful - 2 fun6 insightful - 1 fun7 insightful - 2 fun -  (1 child)

WOW. Impressive work.

[–]raven9[S] 4 insightful - 1 fun4 insightful - 0 fun5 insightful - 1 fun -  (0 children)

Thanks I appreciate that. You might be interested in this small update.

Here is an example when they isolated the virus from a patient in Korea, https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7036342/

Here is the genome they sequenced from that isolate https://www.ncbi.nlm.nih.gov/nuccore/MT039890

If you scroll down through that genome to to the section where it says, /gene="S" /note="structural protein" /codon_start=1 product="surface glycoprotein" The sequence following that is the spike protein. You can also view that Korean spike protein sequence separately here https://www.ncbi.nlm.nih.gov/protein/1807860441

You can compare it again with the image from the Indian research paper. https://www.biorxiv.org/content/biorxiv/early/2020/01/31/2020.01.30.927871/F2.large.jpg

You should see they are similar both beginning with the sequence, MFVFLVLLPL

Also notice this Korean isolate does not have the 28 nucleotide sequence at the end that matches HIV gp41 as in the other spike protein genome here https://www.ncbi.nlm.nih.gov/protein/6VXX_C So the Korean isolate is further proof there are two lab engineered virus. One with 4 inserts that match HIV, the other with 5.

[–]Ehhhhhh 5 insightful - 2 fun5 insightful - 1 fun6 insightful - 2 fun -  (1 child)

Could there be a link as to why some states had decriminalized or repealed laws in regards to HIV transmission?

[–][deleted] 3 insightful - 2 fun3 insightful - 1 fun4 insightful - 2 fun -  (0 children)

R kelly has herpes and was sued for giving it to women unwillingly recently, not telling them about it. That was criticized because some say that should not be criminalized. It's tough since covid is more contagious, thru the air not just thru blood or semen. I want anyone with an STD to be quarantined, given a scarlet letter, anyway to keep them from having sex. Then the virus would disappear in a generation. With covid, some say it's not that big a deal but it is. We have tough decisions on that as more realize the vaccine doesn't work and social distancing is the only way to stop it. Yes masks don't work either.

[–]IkeConn 4 insightful - 1 fun4 insightful - 0 fun5 insightful - 1 fun -  (0 children)

ELI5

[–]ActuallyNot 3 insightful - 1 fun3 insightful - 0 fun4 insightful - 1 fun -  (21 children)

Didn't we do this a year and a half ago?

The similarities of the inserts to HIV are not unique to HIV-1, and sit in many viruses.

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7033698/

Viruses naturally change like this, commonly if the find themselves infecting a cell that is also infected by another virus.

This does not imply engineering, nor even HIV as the source.

[–][deleted] 6 insightful - 2 fun6 insightful - 1 fun7 insightful - 2 fun -  (4 children)

HIV also a bioweapon

[–]ActuallyNot 1 insightful - 1 fun1 insightful - 0 fun2 insightful - 1 fun -  (3 children)

Isn't it a zoonotic virus, related to SIV?

[–][deleted] 4 insightful - 2 fun4 insightful - 1 fun5 insightful - 2 fun -  (2 children)

yeah, like with the bat virus, it doesn't really hurt apes. They're adapted to it. Then though humans messed with it in a lab to get it to infect humans then released it.

[–]PriestTheyCalledHim 1 insightful - 1 fun1 insightful - 0 fun2 insightful - 1 fun -  (1 child)

HIV is not a bioweapon. It was spread from chimpanzees to humans via consumption of raw or under cooked bush meat in Sub-Saharan Africa, vaginal and anal sex without condoms and prostitution, blood transfusions and medical professionals not using new or sterile equipment, and IV drug users sharing needles.

[–][deleted] 1 insightful - 1 fun1 insightful - 0 fun2 insightful - 1 fun -  (0 children)

it's a bioweapon sorry

[–]Questionable 5 insightful - 2 fun5 insightful - 1 fun6 insightful - 2 fun -  (7 children)

Viruses naturally change like this,

No, they really don't. And Germ Theory is as big a fraud as Fauci is.

https://www.bitchute.com/video/B1OuvLzH6P5i/

[–]ActuallyNot 1 insightful - 1 fun1 insightful - 0 fun2 insightful - 1 fun -  (6 children)

Germ Theory is a fraud?

What causes infections?

[–]Questionable 3 insightful - 2 fun3 insightful - 1 fun4 insightful - 2 fun -  (4 children)

Right, the answers are in the video. If you can watch it where you... Reside.

Ĥ̅͛ǝ̮̺͕̲̰llo ʍoɹlp' I,m Qnǝsʇᴉouɐqlǝ.̬̘̟ͅ

[–]ActuallyNot 1 insightful - 1 fun1 insightful - 0 fun2 insightful - 1 fun -  (3 children)

Nah. But I already know how the medical advances that have been made by germ theory. And I take a mild amateur interest in infectious diseases, because of Mark Crislip's ID blog (Rubor, Calor, Dolor, Tumor).

So your video, however delightfully crackpot, wouldn't have worked on me anyway.

[–]Questionable 1 insightful - 1 fun1 insightful - 0 fun2 insightful - 1 fun -  (2 children)

Amazing sir. You appear to be far to smart, to allow for a fool such as me, to infect you with knowledge. Why your ability to reject ideas without entertaining them, proves to all that you posses a truly educated mind.

Solid, unwavering, incapable of growth, like the unmovable object all scholars aspire to be.

You have bested me yet again! ̷̼̎ͅ

Ĥ̅͛ǝ̮̺͕̲̰llo ʍoɹlp' I,m Qnǝsʇᴉouɐqlǝ.̬̘̟ͅ

[–]ActuallyNot 3 insightful - 1 fun3 insightful - 0 fun4 insightful - 1 fun -  (1 child)

Why your ability to reject ideas without entertaining them, proves to all that you posses a truly educated mind.

And yet Germ Theory is how we have antibiotics, antimycotics, and vaccinations. People don't die of smallpox anymore nor and nearly none die of TB.

And the theory works. If you've got a patient with an infection, the infection has a focus, and there's a whole lot of germs there. You take a sample, grow it in the lab, and see what antibiotics it's susceptible to, and those antibiotics make the patient better. If you're in time.

There's no world in which germ theory is wrong. That's not by not considering the alternatives. But I've considered them in the past. And my position is based on what things are true. You should try that some time. It makes discussions less incoherent.

[–]Questionable 1 insightful - 1 fun1 insightful - 0 fun2 insightful - 1 fun -  (0 children)

Amazing! Well said! Wondrous even!!! A flawless victory!

Now...

Although your words are flawless sir. As you are the better man, and I am but a humble beggared at your feet.

Might I advice that next time, try addressing the words that you quote. Not that there is anything wrong with quoting someone, only to ignore those words outright, and go off on a tangent. WELL DONE SIR! I submit without Question! You are all knowing!

I just suspect that the common viewer might be confused by your masterful strategizing! May I add again Sir, most masterful of you! Good show!

I now see the light, and agree to everything that you say! You have won the day hands‎ Down!

...

Ĥ̅͛ǝ̮̺͕̲̰llo ʍoɹlp' I,m Qnǝsʇᴉouɐqlǝ.̬̘̟ͅ

[–][deleted] 3 insightful - 2 fun3 insightful - 1 fun4 insightful - 2 fun -  (0 children)

Even Pasteur admitted on his death bed that he had been wrong all his life, and that the determinant of disease is not the microbe but the terrain. That is, the pre-existing state of the body.

Why else did the Jewish "medicine" go on to make vaccines with mercury, aluminum and formaldehyde in them???

[–][deleted] 4 insightful - 2 fun4 insightful - 1 fun5 insightful - 2 fun -  (1 child)

What's more realistic, a Chinese lab accidentally released a run of the mill bat virus they just happened to run across that is cross species contagious and were studying for purely altruistic pursuits that suddenly spread across the world like it had never before, or they accidentally released the bioweapon they were working on.

[–][deleted] 3 insightful - 1 fun3 insightful - 0 fun4 insightful - 1 fun -  (0 children)

Or they released it on purpose after years of planning a lockstep operation with other corrupt world leaders. That seems more likely than any sort of "accident"

[–]raven9[S] 2 insightful - 1 fun2 insightful - 0 fun3 insightful - 1 fun -  (5 children)

Didn't we do this a year and a half ago? The similarities of the inserts to HIV are not unique to HIV-1, and sit in many viruses.

No we didn't. I have shown here two versions of the same SARS-CoV-2 virus genome. One with 4 sequences that match HIV-1 the other has 5 sequences that match HIV and furthermore, those sequences were all from different strains of HIV-1. It is impossible for that to happen naturally.

[–]ActuallyNot 2 insightful - 1 fun2 insightful - 0 fun3 insightful - 1 fun -  (4 children)

They match HIV-1 but they also match dozens of other viruses, and are common in many mammalian cells.

They're just common sequences.

It is perfectly possible for an RNA virus to pick up sequences of RNA from inside the cell that they reproduce in. That's the normal way they evolve.

[–]raven9[S] 1 insightful - 1 fun1 insightful - 0 fun2 insightful - 1 fun -  (3 children)

No. It cannot happen naturally. Sure you can find one of those same sequences randomly here and there in other organisms but until 2019 you would only find all 4 in HIV. The only way a virus can aquire extra sequences from another virus is by recombination. That requires both virus infect the same cell at the same time. HIV and SARS cannot do that. Firstly they bind to different receptors on different cell types. Secondly the first 4 new sequences were from 4 different HIV genomes. Thirdly recombination would affect the entire genome not just the spike. Forthly when a second version of the SARS-CoV-2 virus shows up and it has a 5th sequence that also matches a sequence from HIV-1 and it is 28 nucleotides long there can no longer be any pretense. It was done in a lab just like nobel prize winning virologist Luc Montagnier said it was.

[–]ActuallyNot 2 insightful - 1 fun2 insightful - 0 fun3 insightful - 1 fun -  (2 children)

Yes. It regularly happens naturally.

Sure you can find one of those same sequences randomly here and there in other organisms but until 2019 you would only find all 4 in HIV.

The insertions probably occurred independently.

In addition, phylogenetic inferences carried out in the vicinity of the insertions (Fig. 5) show that the four insertions found in SARS-CoV-2 cover different sub-groups of coronavirus strains, suggesting that they occurred independently at different times of coronavirus diversification. In particular, the first three insertions are observed in virus sequences isolated not only from human and bats (RaTG13), but also from pangolins from China or Malaysia. The hypothesis that these insertions are the result of recent experimental manipulations would not explain the presence of these sequences in several virus isolates from different species, collected at different locations, especially since these insertions occurred at different times during the evolution of these virus strains. - Source

Secondly the first 4 new sequences were from 4 different HIV genomes.

Yeah, but the first 3 are also from viruses in bats and pangolins. So those insertions could have happened sequentially and long before the jump to humans.

And HIV as a source of the inserts is not supported by the statistical analysis (Fig 5 of the paper above)

Thirdly recombination would affect the entire genome not just the spike.

Not necessarily. But certainly the evidence is that these particular inserts did not occur at once. So I agree that recombination is unlikely. Not least because without the fourth of those inserts, the virus wouldn't infect humans very well at all, so would not be in the same animal as human HIV, much less the same cell, which, as you point out, is also unlikely.

Forthly when a second version of the SARS-CoV-2 virus shows up and it has a 5th sequence that also matches a sequence from HIV-1 and it is 28 nucleotides long there can no longer be any pretense.

That's not a slam-dunk. What matters is how often that sequence is seen in other viruses or RNA sequences that might by hanging around a human or animal cell.

It was done in a lab just like nobel prize winning virologist Luc Montagnier said it was.

That's not impossible. But Montagnier's (off the cuff) analysis is refuted by the statistics in the linked paper, described above. If you look at the entire database of viral sequences, the statistics don't imply HIV-1 as a source.

[–]raven9[S] 1 insightful - 1 fun1 insightful - 0 fun2 insightful - 1 fun -  (1 child)

Please I am not going to waste my time arguing with you shills and liars. Go back to reddit. You seem to forget this was the SARS spike protein. SARS infected barely 8000 people. It did not even have time to gain any natural mutations.

[–]ActuallyNot 2 insightful - 1 fun2 insightful - 0 fun3 insightful - 1 fun -  (0 children)

Please I am not going to waste my time arguing with you shills and liars.

Can you point out the lie?

Did you read the source I linked to?

Do you see that's it's a peer reviewed scholarly paper.

I didn't intentionally misrepresent it, but please point out where I lie about it, and I will correct the post.

You seem to forget this was the SARS spike protein.

What makes you think that?

SARS infected barely 8000 people. It did not even have time to gain any natural mutations.

The source of SARS-CoV-2 (Which, in case you're confused is the COVID-19 virus), mutated in order to jump to humans from bats, via some intermediary that has not been identified, but it might have gone via pangolins.

Those inserts you're talking about would have been part of that process.

[–][deleted] 2 insightful - 1 fun2 insightful - 0 fun3 insightful - 1 fun -  (0 children)

So it the pandemic is real, just not the way the media portrays it?.

[–]skeech 1 insightful - 2 fun1 insightful - 1 fun2 insightful - 2 fun -  (0 children)

covid is a secret, dont talk about it... just get the dammed vaccine and be healthy.

what the hell is wrong with you people?

[–]yoke 1 insightful - 1 fun1 insightful - 0 fun2 insightful - 1 fun -  (0 children)

pretty fucked up if true.

[–][deleted] 1 insightful - 1 fun1 insightful - 0 fun2 insightful - 1 fun -  (1 child)

Reddit recently ramped up their spam/bot detection, and many legit users have been getting caught in the crossfire.

If you're posting on Reddit with a new account, or an old account with very low karma and history, you're probably shadowbanned as a user. Not because of WHAT you're posting, but because of HOW you're acting. Repeatedly posting the exact same thing on multiple subs is spammy.

You can confirm if you're shadowbanned on Reddit by making a post on r/Shadowban, the bots will alert you one way or the other.

[–]raven9[S] 1 insightful - 1 fun1 insightful - 0 fun2 insightful - 1 fun -  (0 children)

Seriously? You are going to come here and defend the most toxic and insidious internet STASI cesspool and blame the user for trying to post on the platform? Why don't you fuck off and go back there. I did not repeatedly post anything. I tried to post it once and it was shadowbanned so I tried on a different sub and it was shadowbanned again. I tried about five times before I quit bothering.